moisture photoabsorption

  • 1 Moisture — Mois ture, n. [Cf. OF. moistour, F. moiteur.] 1. A moderate degree of wetness. Bacon. [1913 Webster] 2. That which moistens or makes damp or wet; exuding fluid; liquid in small quantity. [1913 Webster] All my body s moisture Scarce serves to… …

    The Collaborative International Dictionary of English

  • 2 Moisture — Damp redirects here. For other uses, see Damp (disambiguation). Dew on a spider web Humidity is the amount of moisture the air can hold before it rains. Moisture refers to the presence of a liquid, especially water, often in trace amounts. Small… …


  • 3 Udic moisture regime — The udic moisture regime is common to soils of humid climates which have well distributed rainfall, or which have enough rain in summer so that the amount of stored moisture plus rainfall is approximately equal to, or exceeds, the amount of… …


  • 4 Moisture ratio — A moisture ratio compares an amount of air to an amount of moisture. A moisture ratio is a ratio that compares the mass or volume of air to the mass or volume of moisture contained in that air. In construction, it is an important consideration… …


  • 5 Equilibrium moisture content — The moisture content of wood below the fibre saturation point is a function of both relative humidity and temperature of surrounding air. The equilibrium moisture content (EMC) is the moisture content at which the wood is neither gaining nor… …


  • 6 Moisture Sensitivity Level — relates to the packaging and handling precautions for some semiconductors. The MSL is an electronic standard for the time period in which a moisture sensitive device can be exposed to ambient room conditions (approximately 30°C/60%RH).… …


  • 7 Moisture vapor transmission rate — (MVTR), also water vapor transmission rate (WVTR), is a measure of the passage of water vapor through a substance. There are many industries where moisture control is critical. Moisture sensitive foods and pharmeceuticals are put in packaging… …


  • 8 Moisture equivalent — is proposed by Lyman Briggs and McLane (1910) as a measure of field capacity for fine textured soil materials. Moisture equivalent is defined as the percentage of water which a soil can retain in opposition to a centrifugal force 1000 times that… …


  • 9 Moisture recycling — In hydrology, moisture recycling or precipitation recycling refer to the process by which a portion of the precipitated water that evapotranspired from a given area contributes to the precipitation over the same area. Moisture recycling is thus a …


  • 10 Moisture stress — occurs when the water in a plant s cells is reduced to less than normal levels. This can occur because of a lack of water in the plant s root zone, higher rates of transpiration than the rate of moisture uptake by the roots, for example, because… …


  • 11 Moisture sorption isotherm — At equilibrium, the relationship between water content and equilibrium humidity of a material can be displayed graphically by a curve, the so called moisture sorption isotherm. For each humidity value, a sorption isotherm indicates the… …


  • 12 Antecedent moisture — is a term from the fields of Hydrology and sewage collection and disposal that describes the relative wetness or dryness of a watershed or sanitary sewershed. Antecedent moisture conditions change continuously and can have a very significant… …


  • 13 Moisture analysis — covers a variety of methods for measuring moisture content in both high level and trace amounts in solids, liquids, or gases. Moisture in percentage amounts is monitored as a specification in commercial food production. There are many… …


  • 14 Antecedent soil moisture — is a term used in surface water hydrology in reference to runoff prediction and in process geomorphology in reference to fluvial patterns in drainage basins. Soil retains a degree of moisture after a rainfall event. This residual water moisture… …


  • 15 Moisture advection — is the horizontal transport of water vapor by the wind. Measurement and knowledge of atmospheric water vapor, or moisture , is crucial in the prediction of all weather elements, especially clouds, fog, temperature, humidity thermal comfort… …


  • 16 Moisture meter — Moisture meters are used to measure the percentage of water in a given substance. This information can be used to determine if the material is ready for use, unexpectedly wet or dry, or otherwise in need of further inspection. Wood and paper… …


  • 17 Soil Moisture and Ocean Salinity satellite — Global soil moisture and ocean salinity measurements are needed to better understand Earth’s water cycle and climate. Currently, there is no thorough dataset on soil moisture or ocean salinity. Current satellites operated by NASA have provided… …


  • 18 Soil moisture sensors — measure the water content in soil. A soil moisture probe is made up of multiple soil moisture sensors. One common type of soil moisture sensors in commercial use include the Frequency domain sensor such as the capacitance sensor. One of the major …


  • 19 Concrete moisture meters — Moisture meters have been used for decades to measure different types of moisture content in different materials and substances. Concrete meters have evolved from the successful wood moisture meter as flooring contractors tried to use their wood… …


  • 20 Moisture Sensitive Level — Der Moisture Sensitivity Level (MSL, dt. »Feuchtigkeitsempfindlichkeitsschwellwert«) bezieht sich auf die Feuchteempfindlichkeit von Halbleiterbauelementen bei der Verpackung, Lagerung und Montage. Inhaltsverzeichnis 1 Hintergrund 2… …

    Deutsch Wikipedia